Cytochrome P450 46A1
>ENSG00000036530|Cytochrome P450 46A1
MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKKYGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRVIDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC
| Identifier | Resolution | Method | Chain | Positions | Source |
|---|---|---|---|---|---|
| 7N6F | 1.40 Å | X-ray | A | 28-494 | PDB |
| 2CIB | 1.50 Å | X-ray | A | 1-451 | PDB |
| 2CI0 | 1.53 Å | X-ray | A | 1-451 | PDB |
| 1X8V | 1.55 Å | X-ray | A | 1-451 | PDB |
| 2W0B | 1.56 Å | X-ray | A | 1-451 | PDB |
| 2W09 | 1.57 Å | X-ray | A | 1-451 | PDB |
| 2W0A | 1.60 Å | X-ray | A | 1-451 | PDB |
| 3MDM | 1.60 Å | X-ray | A | 51-500 | PDB |
| 7N3L | 1.63 Å | X-ray | A | 28-494 | PDB |
| 9NNA | 1.67 Å | X-ray | A | 28-494 | PDB |
| 9NNM | 1.70 Å | X-ray | A | 28-494 | PDB |
| 7N3M | 1.70 Å | X-ray | AAA | 28-494 | PDB |
| 9NNI | 1.70 Å | X-ray | A | 28-494 | PDB |
| 9NNO | 1.80 Å | X-ray | A | 28-494 | PDB |
| 2Q9F | 1.90 Å | X-ray | A | 51-500 | PDB |
| 2VKU | 1.95 Å | X-ray | A | 1-451 | PDB |
| 9NNE | 1.95 Å | X-ray | A | 28-494 | PDB |
| 3MDR | 2.00 Å | X-ray | A/B | 51-500 | PDB |
| 7LRL | 2.00 Å | X-ray | A | 28-494 | PDB |
| 1U13 | 2.01 Å | X-ray | A | 1-451 | PDB |
| 7LS4 | 2.05 Å | X-ray | A | 28-494 | PDB |
| 4FIA | 2.10 Å | X-ray | A | 51-500 | PDB |
| 7LS3 | 2.15 Å | X-ray | A | 28-494 | PDB |
| 2BZ9 | 2.21 Å | X-ray | A/B | 1-451 | PDB |
| 9NNJ | 2.29 Å | X-ray | A | 28-494 | PDB |
| 3MDT | 2.30 Å | X-ray | A/B | 51-500 | PDB |
| 3MDV | 2.40 Å | X-ray | A/B | 51-500 | PDB |
| 2Q9G | 2.40 Å | X-ray | A | 51-500 | PDB |
| 4ENH | 2.50 Å | X-ray | A | 51-500 | PDB |
| 4J14 | 2.50 Å | X-ray | A | 51-500 | PDB |
EcoDrug+ was developed under the PREMIER Innovative Medicines Initiative 2 Joint Undertaking (JU) under grant agreement No 875508. The JU receives support from the EU’s Horizon 2020 research and innovation programme and the European Federation of Pharmaceutical Industries and Associations (EFPIA). The views reflect only the authors’ perspective and the JU is not responsible for any use that may be made of the information EcoDrug+ contains.
Elements of EcoDrug+ were developed under the Biocenter Finland Drug Discovery and Chemical Biology network. CSC-IT Center for Science Ltd is thanked for providing computational resources. Credit is given to Ensembl for collecting species images (provided under public domain licences such as Wikimedia and NHGRI).
Content of EcoDrug+ is provided without guarantee for correctness.
Ashenafi Legehar, Siobhán Monaghan, Mael Briand, Akseli Niemelä, Leo Ghemtio, Ziaurrehman Tanoli, A Ross Brown, Charles R Tyler, Henri Xhaard, EcoDrug PLUS: an advanced database for drug target conservation analysis and environmental risk assessment, Nucleic Acids Research, Volume 54, Issue D1, 6 January 2026, Pages D1397–D1404, https://doi.org/10.1093/nar/gkaf1251
This work is licensed under
Creative Commons Attribution-ShareAlike 4.0 International License
Last update: Monday, 27th July 2026