FILGOTINIB

/static/temp/default.svg Search structure
Synonyms
Status
Molecule Category UNKNOWN
ATC L04AA45
UNII 3XVL385Q0M
EPA CompTox DTXSID80152935

Structure

InChI Key RIJLVEAXPNLDTC-UHFFFAOYSA-N
Smiles O=C(Nc1nc2cccc(-c3ccc(CN4CCS(=O)(=O)CC4)cc3)n2n1)C1CC1
InChI
InChI=1S/C21H23N5O3S/c27-20(17-8-9-17)23-21-22-19-3-1-2-18(26(19)24-21)16-6-4-15(5-7-16)14-25-10-12-30(28,29)13-11-25/h1-7,17H,8-14H2,(H,23,24,27)

Physicochemical Descriptors

Property Name Value
Molecular Formula C21H23N5O3S
Molecular Weight 425.51
AlogP 1.98
Hydrogen Bond Acceptor 7.0
Hydrogen Bond Donor 1.0
Number of Rotational Bond 5.0
Polar Surface Area 96.67
Molecular species NEUTRAL
Aromatic Rings 3.0
Heavy Atoms 30.0

Bioactivity

Mechanism of Action Action Reference
Tyrosine-protein kinase JAK1 inhibitor INHIBITOR PubMed
Protein: Tyrosine-protein kinase JAK1
Description: Tyrosine-protein kinase JAK1
Organism : Homo sapiens
P23458 ENSG00000162434
Targets EC50(nM) IC50(nM) Kd(nM) Ki(nM) Inhibition(%)
Enzyme Kinase Protein Kinase TK protein kinase group Tyrosine protein kinase JakA family
- 25-17453 - - -
Enzyme Kinase Protein Kinase TK protein kinase group Tyrosine protein kinase JakB family
- 25-17453 - - -
Enzyme Kinase Protein Kinase TK protein kinase group Tyrosine protein kinase PDGFR family
- 338 - - -
Enzyme Kinase Protein Kinase TK protein kinase group Tyrosine protein kinase VEGFR family
- 274 - - -
Enzyme Kinase Protein Kinase
- 25-17453 - - -
Ion channel Voltage-gated ion channel Potassium channels Voltage-gated potassium channel
- 85000-85000 - - -
Assay Description Organism Bioactivity Reference
Inhibition of JAK1 (unknown origin) Homo sapiens 363.0 nM
Inhibition of JAK1/JAK2/TYK2 in human whole blood assessed as inhibition of IL-6-induced STAT-1 phosphorylation preincubated for 45 mins followed by IL-6 addition measured after 15 mins by FACS analysis Homo sapiens 918.0 nM
Inhibition of human recombinant JAK1 Homo sapiens 10.0 nM
Inhibition of JAK1/JAK3 in IL4-induced human THP1 cells assessed as pSTAT6 Homo sapiens 154.0 nM
Inhibition of JAK1/JAK3 in IL2-induced human NK92 cells assessed as pSTAT5 Homo sapiens 148.0 nM
Inhibition of JAK1/TYK2 in IFN-alphaB2-induced human U2OS cells assessed as pSTAT1 Homo sapiens 436.0 nM
Inhibition of JAK1 in human whole blood assessed as inhibition of IL-6-induced pSTAT1 Homo sapiens 629.0 nM
Inhibition of human FLT3 (unknown origin) Homo sapiens 338.0 nM
Inhibition of human FLT4 (unknown origin) Homo sapiens 274.0 nM
Inhibition of human CSF1R (unknown origin) Homo sapiens 489.0 nM
Inhibition of rat JAK1 Rattus norvegicus 29.0 nM
Inhibition of JAK1 (unknown origin) Homo sapiens 10.0 nM
Inhibition of JAK2 (unknown origin) Homo sapiens 25.0 nM
Inhibition of JAK3 (unknown origin) Homo sapiens 810.0 nM
Inhibition of Tyk2 (unknown origin) Homo sapiens 116.0 nM
Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 55.66 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 50.1 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 48.29 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 47.07 nM
Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 41.16 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 31.37 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 55.49 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 167.34 nM
Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 86.77 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 79.07 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 72.7 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 73.75 nM
Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 189.3 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 194.7 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 187.3 nM Inhibition Assay: In vitro inhibition assay using various enzyme. Homo sapiens 149.35 nM
Inhibition of human JAK1 using GEEPLYWSFPAKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method Homo sapiens 10.0 nM
Inhibition of human JAK2 using [protein fragment, 39 aa] as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method Homo sapiens 28.0 nM
Inhibition of human JAK3 using GGEEEEYFELVKKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method Homo sapiens 810.0 nM
Inhibition of human TYK2 using GGMEDIYFEFMGGKKK as substrate after 40 mins in presence of [gamma-33P-ATP] by scintillation counting method Homo sapiens 116.0 nM
Antiviral activity determined as inhibition of SARS-CoV-2 induced cytotoxicity of Caco-2 cells at 10 uM after 48 hours by high content imaging Homo sapiens 2.55 %
SARS-CoV-2 3CL-Pro protease inhibition percentage at 20µM by FRET kind of response from peptide substrate Severe acute respiratory syndrome coronavirus 2 18.03 % SARS-CoV-2 3CL-Pro protease inhibition percentage at 20µM by FRET kind of response from peptide substrate Severe acute respiratory syndrome coronavirus 2 1.877 %
Antiviral activity determined as inhibition of SARS-CoV-2 induced cytotoxicity of VERO-6 cells at 10 uM after 48 hours exposure to 0.01 MOI SARS CoV-2 virus by high content imaging Chlorocebus sabaeus 0.2 % Antiviral activity determined as inhibition of SARS-CoV-2 induced cytotoxicity of VERO-6 cells at 10 uM after 48 hours exposure to 0.01 MOI SARS CoV-2 virus by high content imaging Chlorocebus sabaeus -0.11 % Antiviral activity determined as inhibition of SARS-CoV-2 induced cytotoxicity of VERO-6 cells at 10 uM after 48 hours exposure to 0.01 MOI SARS CoV-2 virus by high content imaging Chlorocebus sabaeus -0.11 % Antiviral activity determined as inhibition of SARS-CoV-2 induced cytotoxicity of VERO-6 cells at 10 uM after 48 hours exposure to 0.01 MOI SARS CoV-2 virus by high content imaging Chlorocebus sabaeus 0.2 %
Inhibition of JAK1 (unknown origin) in presence of ATP at Km concentration by caliper assay Homo sapiens 115.0 nM
Inhibition of JAK2 (unknown origin) in presence of ATP at Km concentration by caliper assay Homo sapiens 74.0 nM
Inhibition of JAK3 (unknown origin) in presence of ATP at Km concentration by caliper assay Homo sapiens 623.0 nM
Inhibition of recombinant JAK1 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay Homo sapiens 26.2 nM
Inhibition of recombinant JAK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay Homo sapiens 171.0 nM
Inhibition of recombinant JAK3 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay Homo sapiens 932.0 nM
Inhibition of recombinant TYK2 (unknown origin) using GFP-STAT1 as substrate incubated for 1 hr followed by anti-pSTAT1 antibody addition and measured after 30 mins by Lanthascreen TR-FRET assay Homo sapiens 65.3 nM
Inhibition of recombinant human JAK1 assessed as phosphorylation level in presence of 1 mM ATP Homo sapiens 636.0 nM

Cross References

Resources Reference
ChEMBL CHEMBL3301607
DrugBank DB14845
FDA SRS 3XVL385Q0M
Guide to Pharmacology 7913
PDB 2HB
PubChem 49831257
SureChEMBL SCHEMBL253559
ZINC ZINC000096174616
CONTENTS